TCDB is operated by the Saier Lab Bioinformatics Group
>tr|A8PYS5|A8PYS5_BRUMA Voltage-gated calcium channel, L-type, alpha subunit. C. elegans egl-19 ortholog OS=Brugia malayi GN=Bm1_39550 PE=3 SV=1
MASSTEEDDHHAEDPHKSDLWQQTLQAAVAATSQSEAAKKRQQQRKPMRQNNVVERSERSLLCLTLSNPLRKACITIVEW
RPFEWLILLMICANCIALAVYQPYPAQDSDTKNIILEQIEYLFIVVFTIECVLKVIALGFLFHPGAYLRNAWNILDFIIV
VIGLVSTALSRMNIQGFDVKALRAFRVLRPLRLVSGVPSLQVVLNAILRAMIPLLHIALLVMFVIIIYAIIGLELFCGKL
HSTCFDPTTGELAQHTPSTCGFASSAFHCQPNGHYEGVHWVCTSNTSWQGPNNGITNFDNFGLAMLTVFQCVSLEGWTDV
MYWVNDAVGREWPWIYFVTLVILGSFFVLNLVLGVLSGEFSKEREKARARGLFQKFREKQQLEEDLKGYLDWINQAEDIE
PVNDDEQEDEQQFNGEELDEETDEKTDDSRPSWWKKRLRRMQKLNRRCRRGCRRLVKSQTFYWLVIVLVLLNTLVLTTEH
YKQEPWLDHFQTVANLFFVILFSMEMILKMYSLGLTTYTTSQFNRFDCFVVISSIVEFVLVYFDLMKPLGVSVLRSARLL
RIFKVTKYWTSLRNLVSSLLNSLRSIMSLLLLLFLFIVIFALLGMQVFGGKFNFNPMNPKPRANFDTFIQALLTVFQILT
GEDWNTVMYNGIASFGGVGSWGVLVSVYFIVLFICGNYILLNVFLAIAVDNLADADSLTNAEKEEEQAEVEEEVAEDDYE
DEKYDENGNEETRDDSRIVMEEEEEGGEIITARPRRMSELVTAKQQKPIPKASSLFILSHTNPFRVFCNKIVNHSYFTNS
VLICILVSSAMLAAEDPLEAQSPRNTILNYFDYFFTTVFTVEITLKVVVYGLMFHKGSFCRNAFNLLDILVVAVSLVSFV
LKSDAISVVKILRVLRVLRPLRAINRAKGLKHVVQCVIVAVKTIGNIMLVTFMLQFMFAIIGVQLFKGTFFRCTDESKMT
EYECRGEFLAYEDGDPMKPLRMRREWIKNDFNFDNVGDAMISLFVVSTFEGWPDLLYVAINSNEEDHGPVYNARQAVAIF
FITFIVVIAFFMMNIFVGFVIVTFQNEGEREYENCELDKNQRKCIEFALKAKPHRRYIPRNRFQYRVWWFVTSQFFEYVI
FIIILLNTTTLAMKHYPPDPGMDHVLDVLNLIFTGVFALEAVFKIIALNPKNYFGDRWNAFDFVIVLGSFIDIIYGKLSP
GSNIISINFFRLFRVMRLVKLLSRGEGIRTLLWTFMKSFQALPYVALLIVLLFFIYAVIGMQVFGKVALNDETHIHRNNN
FHTFPAAVLVLFRSATGEAWQEIMLSCSDRDEVKCDPASDDYKQNPDAKCGVDFAYPYFISFFMLCSFLVINLFVAVIMD
NFDYLTRDWSILGPHHLEEFVRLWSEYDPDAKGRIKHLDVVTLLRKISPPLGFGKLCPHRLACKRLVSMNMPLNSDGTVC
FNATLFALVRTNLKIYTEGNIDEVNEQLRSAIRRIWKRTPQKMLDEVVPPAGRDDDVTVGKFYATFLIQDYFRRFKKRKE
LESKGIVPQQTSQAMALQAGLRTLHEIGPELKRAISGNLETDFTLDVEEPQHRRPHSLFNNIISALGGSARANQIYREDR
TTRSLSMTANNQLSPTRSLYGNNDMVSVTAHGHLTSNCSINIPPSARSNGGVLQRRLPQIPSPNISFNQKLLENDLLVSR
LALNAESHYILANRSMPLDTDEEEEWGERRDTNRLRNDETWMNNGRPGKGLRKPFMLARNQAMAIAGVPADISEAFEGTY
RPAPDGKSVRLPLSNRPVLRPDRNEEGLTGRLVGEALALGRYMDERVVEAARREIAEAYSLEESELESAAATLADARYME
HLGMERCEVRDFNRYSARALLRPAPSQEAPEDDLFITTL