TCDB is operated by the Saier Lab Bioinformatics Group
>tr|A8ZVE8|A8ZVE8_DESOH Putative uncharacterized protein OS=Desulfococcus oleovorans (strain DSM 6200 / Hxd3) GN=Dole_0799 PE=4 SV=1
MLAIIAFFGLYLAGQVAMGKGLLLGTLFSVVNFVLMGETLPSRLAPTKRRRITAALGSMGMRFALMAVPIVLAIRLDTYN
LATVMIGLFSVQGVLLADGVLGRRAWREQFSESE