TCDB is operated by the Saier Lab Bioinformatics Group
>tr|A9RNL0|A9RNL0_PHYPA Predicted protein OS=Physcomitrella patens subsp. patens GN=PHYPADRAFT_68596 PE=4 SV=1
MRKKVRKKTPLPEIQEEGLLTPLRRGQSAYLQQTCPDFRRFPDLEYGPQSESSLTSHVEMAAALVDQAMMGRWMPLAVVY
HKDYESAKSAFLLYHQLSFVRGLVYFLLMVLPFFEIPAWCDGDLPHPCGDSKKYPLSGLPYVRSWTSVTIQVIVLGLMII
STLTSSIGLSELRGINISMYIRLLVPVVFSRAIRGCFRMTVRIIHTFMDIAVLVGTFVLLSAWVATALFSDTSVDFKDFS
TSLLSLFVLLTTANNPVVWASTYNANRLAFFFFFFYMVVGLYFLMNLAFSVIYSSYKAQMAVEVAKRITARQGNLRAAFS
LLDTRHQEWIDGATMIALFLAIGRYRHIPDVRARASRLFLALNKRGDFKIWSDEFEELCDVIAKEVERQPDMARLKRRRS
NSDMHFVKHPFYNYECGGLPTFLPSLHPANNLTQPNKPRYIHASSNIGYFLHLKLVTRTAWYMLMQVGGAVQMLLINLEF
LFGNGRSSISSRVVFRQYDYVILTFGMVMGGWIFVMDGVLKICVQGWKSYWRTRVNRFDFVVTLLIVAVQAASFYNDDAR
HWVSYLTIARCFRILALVTMISRWRLMGETLVHVIPATAPILALQFLVCSLFALLGMHLFGGLIYKDNPALVGTEYAQHQ
FYAFNFNDYPSAMATCFNLCVVNKWYVFMDAYAAVTGTRWSRTYFIAFWAIAVAFTLNVVVAFFAEAFTSQMEKAEKLKA
RDKRSAEQDLLPRGGALLRKKSGGGAGALPRRAAKSLSYYDLYEDIVQKT