TCDB is operated by the Saier Lab Bioinformatics Group
>tr|A9V5D8|A9V5D8_MONBE Predicted protein OS=Monosiga brevicollis OX=81824 GN=10159 PE=4 SV=1
MSNSAVDTVRTIDGIQGLFTFGVRLDGFSGACRTFKAWWRWAGACAGVPGFSSPILDSAMWQTIWTWDLIAFGVSHAIAG
LVAAFKFRREKITVVMLLPIIFTGLGLLFSAVVGLITALLIAGIYTSAGFKMTTTEVCGLPMPRAFVFMGFPHSLTLPKS
PAPTNAIGSGLGCGSICSLLHHVFFSKLCHLVNDQSLPHQVSGFDGKGGLWSIVNLCCPSPQADKATRQASRQPQRKKPL
VVISMGQSRNKTTIMTTKAMM