TCDB is operated by the Saier Lab Bioinformatics Group
>tr|A9V8N9|A9V8N9_MONBE Predicted protein OS=Monosiga brevicollis GN=33945 PE=4 SV=1
MISAQGAIQLACPALLTLCLALACAMVRNELGVATLTLPLPSVGNTAFTITPRQTVGQLLRDVRQEDQTVQTIRILSHND
VAFAASSMWAEVAREPFQIQMDGTTIHVDAMADWKLGDAAQTASETAVMLDRLSYSVQVLEAEQAHREQLKTRIAQLRDE
LQPMEEIRRDAERRAMWFSSKDAWATLAFLGFGFGFMGRLTWWEYSWDLMEPVTYFVGLGVNICFFGYYLLTHRDYSYEV
AKERAELKAFYRLAMKRGVDVSRYNTRGHENTKQHTHTHTHTHTKYSKHRVQANKRLCLLRPSFAGYSCGLPLSPRRGDE
VFATSAMQHDEVIWNIINQNFCSFKVKTENQTFCRNKYNVTGLCNRQSCPLANSQYATVREFDGKLYLMMKTIERAHTPR
NMWEKIKLKTNYEQALAQIDEHLQYWPKFLVHKCKQRLTKMTQYLIRARRLQLKTQRKLVTVNKKVEQREAKREQKALVA
AKINKAIEKELLDRLRKGTYEGVYNFSEEAFENVINDKEVIEEGEDEDEEELEDEEEFVADYSEEQLDDLFEDGSWEDAV
AAIEGEGDDDDEDDDEEDDDDTGKSASAPAPRKRGAKGAKGGKRRAQDRSDADDEQVVPQALLDKLRRKKRPAKVSIEYE
HEVEPAARAAAHDDQGDW