TCDB is operated by the Saier Lab Bioinformatics Group
>ABR84348.1 methyl-accepting chemotaxis protein [Pseudomonas aeruginosa PA7]
MMDLLKHLIPDFAHMFSANPNGISAWFWSATALIFGLSLYFLFVHFRRFRTRLRALRSLLEGQSKETLALSRRETMQKAQ
GLDAPNVGMLWREFDESLVLSSDQKHLFNTLDAEHFFNARTLAPGLTASRLLAAAPSFLVAIGVLGTFVGLTVGLEGLVG
TSDEIEALKGGINKLISGAAVAFMTSVWGVFFSLLLNFVEKMFERSALGQIQQLQHDIDFLYPRIPAEQSLVHIAEYGKE
SKEALQELHERIGDRLQETLNGMSEAMQTALTDALNNIMAPAIQTLVSTTSQQSTQVLEKLVGNFMDGMTSVGREQGLQM
QQAAADVNAAVSGMSERLNQLFSSLNEQQGRQMEVAQQQSAAFETQLQRISGSAEERQAQMEQRFAELMSGLTNQLQTQL
GTAQQRDEERQVLFERLLGQASSSQTAMLEQFSSSTREQMQAMAEAGNERHSNLEKVFSRLMMNLNTQLDSQMGAAEQRE
QARQQRFQEQLDQVSTHQQELLSGLASAVQATQQQSRLMADQHQQLLGQLKQVSDATAQSSKHMDSSANQLGLLSANLRQ
AADSLGQRLEAVSHSIERAGQQNAELATQLQSQAATLAQLQATLLEGAQRFEQAAGEARNGFGEMKSAQQEFLSSVRHEF
TALGEKLREQVEAVEKQAEEWLRSYAGEVRVQTDERMNQWNEVSLKYADQMHRVVQNMSSILDELEAR