TCDB is operated by the Saier Lab Bioinformatics Group
>AEX77393.1 hypothetical protein CDHC02_1904 [Corynebacterium diphtheriae HC02]
MNHMDNINHWVALSTGEGNIVTTIFNLLKDIAKIGKAIAELIGLAK