TCDB is operated by the Saier Lab Bioinformatics Group
>AJP61612.1 vpu protein [Human immunodeficiency virus 1]
MQSLTVYSIVALVVVDRLAMFFWSTGLLEHEMVVKQQKRYNKTEIFRPGGGDMRDIGDESAGELAKLVERGHLVPGNMDD
L