TCDB is operated by the Saier Lab Bioinformatics Group
>AKM77924.1 lysine exporter protein LysE/YggA [Candidatus Wolfebacteria bacterium GW2011_GWB1_47_1]
MKIFKNGLITGLLLQLAVGPVFFFIVNLTLQKTILDGFVAVFAVTLVDYLYITLAILGIGKLFEKKKVKRIFSIVSSIVL
MIFGVILIKGILGSNISINVATDSKNLLTSFTSVFFLTISSPMTIVFFTSLFTAKTVQYNYAKRELVIFGFATGLATFIF
LGLTVFLSSLIKGNIPMLLIQFLNALVGCLLIGYGAVRLRTVLKNSV