TCDB is operated by the Saier Lab Bioinformatics Group
>AKM78992.1 O-antigen polymerase [Candidatus Beckwithbacteria bacterium GW2011_GWC1_49_16]
MVWQYRLFYLILFLLPTNLARHFILPSSYVSGTLVDYLVPTVYLTDFLIFLLLGLWFSSSSRPKGRGPTAVFLALLLPSV
IFSASFVPAAYKWLKFFELSLFSLWIRRHIDLKIHLPSIAKTLSLAVLFQSLLALTQWLNQSSIFGFWFLGEQPYTDATP
GIDKITWFDGSLKVPPLGTTPHPNVLGGFLAVTLPLVIRQHLQGLSLKVNFLRTTYYGLLITAGVASLFLTFSLSAWLGF
LLIGLPAATLLQTDSLKQKLRAKQLALIKDLPRFSFWQDRLSNPTPGVEEFFTPGVKSVAVKLVAFYAGVLLLFLVFAQN
LSFLAPQSSFSRRSQLTQMALSMVKESPLTGVGLNNFTVIMDRYGLIPATTRFLQPVHNVYLLILAETGILGLAGFLYLI
FSPFYRAIKSKNYSLPITLYGLLLFLGLFDHYPLTLQPGLLFLFLLSSLI