TCDB is operated by the Saier Lab Bioinformatics Group
>AKM79444.1 polysaccharide biosynthesis protein [Candidatus Beckwithbacteria bacterium GW2011_GWC1_49_16]
MIGKNALIQIISSSLSGLITFFTLSLSARLFGPSVLGNVAYVTGLLGLVFAFSDLGFSRAQVYFTAILKKPGKTLGTFLR
LKLFLLFAAVIIALIFALFKQATFQGLFFLMLTYELTTRLAESVFITFEGLGESLSQNFARFIGKLLRLAAVIVFGVSLK
NNFGYSLTFVAEGLGLLILAAVLARRFLPLNFSRNLVQKYFKYSLPFFAIIPLSYFHDNSLVVILRHFHPANQVGFFSAS
FQLVSFLKTLYGAVMIFFFPKMSALFSKKDLEGVKRYTHLAGKYLTTLFAPIFLAAWLFRHTIIKTVLGVEFLPVAPIFS
LLLASTFWLMLVAPYDQLLFASKNHRPLILVNLADLAIVVLVSFWLVPQYGALGTVIAVSSSWFIGGLWHLWLVKSRLKI
TPKFFGLLNRQDIKYFKSLLKLA