TCDB is operated by the Saier Lab Bioinformatics Group
>ALM13851.1 hypothetical protein PeribacterD2_0046 [Candidatus Peribacter riflensis]
MTVFFALVGKLLPLYLFIAAGYVLGVFLHLKRRPVALLLLYVLSPIVVFEGGWTAPLSRGTLALPLIFLVICSVLCVIFY
LASGLVWKRGDTMRNLAAFASANGNSGYFGIPAGLALFGQQSLSIIVLCSLGFVLYESSTGFFTLARGNFTVRESLRKAA
ALPMLYAFALGIIFNIWHMPEPAMVSVFLGDVRSAFSVLGMLLIGVSLAGEKFSAIDGRLLAFTTVAKTIIWPALMLCLI
ALDRQVFQVFSEDVHGVLLLMGMIPLAVNTVVYSSVLKVHPEKAAVAVMVSTVLALFFIPALSAVFLQ