TCDB is operated by the Saier Lab Bioinformatics Group
>AMA11217.1 ATP-binding cassette protein G2 [Mesocricetus auratus]
MSSSNDHVLVPMPQRNTNGLPGMNASDMKTLTGDVLSFHHITYRVKVKSGFFVRKTVEKEILSDINGIMKPGLNAILGPT
GGGKSSLLDVLAARKDPRGLSGDVLINGAPQPANFKCTSGYVVQDDVVMGTLTVRENLQFSAALRLPETMKSHEKNERIN
KVIKELGLDKVADSKVGTQFTRGVSGGERKRTSIGMELITDPSILFLDEPTTGLDSSTANAVLLLLKRMSKQGRAIIFSI
HQSRYSIFKLFDSLTLLASGKLMFHGPAQEALEYFASAGYHCEPYNNPADFFLDVVNGDSSAVVLNREEGEQEANKTEEP
SKREKPIIETLAEFYANSPVYRETKADLDRLPVAQKKKGMSAFKESTYVTSFCHQLRWIAKRSFKNLLGNPQASIAQIIV
TIILSLVIGAIYFDLKNDRSGIQNRAGVLFFLTTNQCFTSVSAVELFVVEKKLFIHEYISGYYRVSSYFFGKLMSDLLPM
RLLPSVIFTCILYFMLGLKKEPGAFFIMMFSLMMVAYTASSMALAIAAGQSVVSVATLLMTISFVFMMIFSGLLVNLKTI
EPWPSWLQYFSIPRYGYTALQYNEFLGQDFCPGLNATANETCSNSFAICTGDEYLESQGIELSPWGLWQNHVALACMIII
FLTIAYVKLLFLKKYS