TCDB is operated by the Saier Lab Bioinformatics Group
>AON76441.1 multidrug resistance protein 4 [Gyps himalayensis]
MEAVPREEKPNPLRDANLCSRLFFWWLNPLFIIGHKRKLEEDDMYKVLPEDSSKKLGEDLQWYWDKEVQKAKKRGKTPHL
TKAIILCYWKSYLVLGIFTMIEETLKIVQPIFLGKIITYFENYDASDEVALNVAYCYAAALSVCTLILAIMHHLYFYHVQ
RAGMKLRVAMCHMIYRKALRLSNVAMAKTTTGQIVNLLSNDVNKFDQVTIFLHFLWAGPIQAVAVTVLLWMEIGPSCLAG
MAVLIILLPIQTCIGRLFSSLRSKTAALTDVRIRTMNEVISGMKIIKMYAWEKSFAELVSGLRRKEIAMVLKSSYLRGLN
LASFFVASKITVFMTFMAYVLLGNVISASRVFVAVSLYGAVRLTVTLFFPSAVERVSEAVVSIRRIKNFLILDEVSHFKP
QLHDNNENVILHVQDLTCYWDKSLESPALQQLSFTVRQGELLAVIGPVGAGKSSLLSAVLGELPKEKGLINVSGRIAYVS
QQPWVFSGTVRSNILFDKEYEREKYEKVLKVCALKKDLDLLANGDLTVIGDRGATLSGGQKARVNLARAVYQDADIYLLD
DPLSAVDAEVGRHLFEKCICQALHQKICVLVTHQLQYLRAATQILILKDGKMVGKGTYSEFLRSGIDFASLLKKEEEVEQ
PSVPGTPNLKSSRSRTFSESSVWSQDSSIHSVKDGAVEQPPTENALAAVPEESRSEGKISFKVYRKYFTAGANYFVIFIL
VLFNILAQVAYVLQDWWLSYWANHQGKLNVTTNGNNGANETEHLDLAFYLGIYAGLTVATILFGIIRSLLVFQVLVNSGQ
TLHNKMFKSILKAPVLFFDRNPIGRILNRFSKDIGHLDDLLPLTFLDFVQTLLQIFGVVAVAVAVIPWILIPLIPLFILF
IFLRRYFLDTSRDIKRLESTTRSPVFSHLSSSLQGLWTIRALKAEDRFQKLFDAHQDLHSEAWFLFLTTSRWFAVRLDAI
CAIFVIVVAFGSLLLAKTLNAGQVGLALSYAITLMGTFQWGVRQSAEVENLMISVERVMEYTDLEKEAPWETNKHPPPEW
PSHGMIAFENVNFTYSLDGPLVLRHLSVVIKPEEKQSLLHTSESQAVGNCPLVSVGIVGRTGAGKSSLIAALFRLAEPEG
RIWIDKYLTSELGLHDLRKKISIIPQEPVLFTGTMRKNLDPFNEYTDEELWNALEEVQLKEAVEDLPNKMETQLAESGSN
FSVGQRQLVCLARAVLKKNRILIIDEATANVDPRTDEFIQKTIREKFAHCTVLTIAHRLNTIIDSDRIMVLDAGRLKEYG
EPYILLQEKDGLFYKMVQQVGKTEAASLMETAKRVYFRKNYPEVVQNGQLATDSSLDPSSGLCITETAL