TCDB is operated by the Saier Lab Bioinformatics Group
>ARC67021.1 ABC-2 transporter protein [Bacillus licheniformis]
MRSVFIVFAGVLIAKLVIGEYKNRTITVMFTYPVSRKKLMAAKLLLTGGLTFLTMIVSELILAFIFSQLNDVYQFSPEKL
TMHDVGNEIGSMLIYAASSTGLSFIPLYFGMRKQSVPATIVTSCILTTLIGQQSDEFSLASIIYIPISLALVGIAIAFWS
IRKIDQEDVL