TCDB is operated by the Saier Lab Bioinformatics Group
>ARD25213.1 BM2 protein [Influenza B virus (B/Maryland/03/2017)]
MFEPFQILSIFSFILSALHFMAWTIGHLNQIKRRVNMKIRIKGPNKETINREVSILRHSYQKEIQAKEAMKEVLSNNMEV
LSDHIVIEGLSAEEIIKMGETVLEVEESH