TCDB is operated by the Saier Lab Bioinformatics Group
>ARE31046.1 ABCC1 protein [Helicoverpa armigera]
MSYNSTLDSFCGSQFWNSSLTWYTDSPELTPCFQKTVLVWTPCLYLWAAAFLDTYYILNSKERNIPWNILNISKLLITCL
LIVLKFVDLGVTVHTSSQGEKEVFNADYYSPIIKILTFCLSATLLYYNRKYGMRASGVLFFFWLLLILAGLPQLQSEVKA
HYNLSDDENVQYNFVSYMVYYPLIILMFLLNCFADLPPKDTPYKYEKNQCPENASGFPSRLTYSWFDPLALTGFRRSLTE
EDLWALNPQDSSTEVVPKFDKFWEKSLRKREISNATKATYRKTSASVNFKPESEKKPASILPALCLAFGGQFLFGSMLKL
FNDVLMFLSPQLLKLLIGFVQGKEPIWKGYVYAVALLACATVQTMLLAHYFTRMYLVGMRIRTALTSAIYRKSLRMSNSA
RKESTVGEIVNLMSVDAQRFVELTAYLNMIWSAPLQIALALYFLWGILGPSVLAGLAVMIILIPVNGLIANRVKTLQIRL
MKYKDERVKLMNEVLNGIKVLKMYAWEPSFEDQILKIRNKEMNVLKQTAYLNSATSFIWSCAPFLVSLMSFGCFVLVNDT
EVLDSKRAFVALSLFNILRFPLSMLPNVISNVVQTSVGIKRLNKFMNCDELDVTSVEHDPKDPNPISIENGHFTWGEQDS
EPFLKNITLHVPRGSLIAVVGAVGSGKSSLLAALLGEMNKLSGRVNTTGTIAYVPQQAWIQNATLQDNILFGKPLDKQKY
NNVIDMCALKPDFEVLPGGDQTEIGEKGINLSGGQKQRVSLARAVYCDADNYFLDDPLSAVDSHVGKHIFDKVLGPAGLL
KHKTRVWVTHNVSYLMHTDLVVVLRDGEVSEAGSYQQLLEKKGAFADFLLHHLSDAERTSPEELDKIKQDLESKLGTEFQ
HKLQRARSLSESASESEQAAAGDRAGSVKRKTPEATPNELKEKNKLIEAEKTETGSVKWGVYKHYLMSVGILSSVITVLM
NLILQVFQVGSNYWLTEWANDDKMLVNGTVDTKRRDMYLGVYGGLGIGQALASIFADLMPFLACWRAARILHELLLDHVL
KAPLQFFEVTPLGRIPSRFSKDMDILDTSLPSQISDLMWCTFEVLGTLFVISFSTPIFMAVILPIGFIYYVIQRFYVATS
RQLKRLESVSRSPIYSHFGESITGSSTIRAYGVSERFIEESERGVDHNQSCYYPSCIANRWLAIRLEMIGNLIIFFSAMF
AVLNRDTISAGLVGLSVSYALQITQTLNWLVRMTSEVETNIVAVERIKEYAETEQEAPWAIGAGPPATWPETGALQLERL
TLAYRAGAEPALRDVTCAVAPRDKLGIVGRTGAGKSTLTLGLFRIVEAVGGRILIDGLDIATMGLHQLRSRITIIPQDPV
LFSGTLRMNLDPFETFSDEDIWRALEYAHLKPFVQGLPAGLRHEVAEGGENLSVGQRQLVCLARALLRKTPLLVLDEATA
AVDLETDELIQKTIRSEFASCTVLTIAHRLNTIMDSTKVMVLDKGQLVEYAPPDQLLQDKNSVFYSMAKDAGLVN