TCDB is operated by the Saier Lab Bioinformatics Group
>tr|B0MXU0|B0MXU0_9BACT Uncharacterized protein OS=Alistipes putredinis DSM 17216 GN=ALIPUT_01952 PE=4 SV=1
MKKIFILAIILLSGTAAASAQEFLTINPDVRTAGMANASVATTGGAYSVFQNAASSLFSHNLFEVGFSYSPWMRDVKKGY
DLMAFGGFYSFNHKHSISFGTRFYREPKLSPDDEDYPFIPKDENNNPIVGIEAFRPLSVSADLAYSYRIGRYLGLSVTAR
YIRSSYGELFTNNALGFDVAAYARIPLNRMLEGAWVSAGAKISDFGFTFDDSNYDLPTKFSVGGSLFAPIRDSHSLEASV
DLGYRYSSSENKSFGMGIGVEYVLMQMIAVRGGYHVADSHGYDYGTIGAGLRFMHLELDFSYLFAAKKCPWRNTYQVGVG
LYF