TCDB is operated by the Saier Lab Bioinformatics Group
>tr|B0W7B6|B0W7B6_CULQU XK-related protein OS=Culex quinquefasciatus GN=CpipJ_CPIJ003229 PE=3 SV=1
MAEFLPLCDVLFNVISLAGYFCNVVFDVVLGYALYERQKFAYFATVIVIVSFSLVISQIVSVRWYLNKRKLRNSTAAATG
PPGDDSPENSLEKKKKKPPVEEPSDSARYSRWVVLALHATQLGVLWRYAKLFVPVDLRHVKHEVRDLCMLRLVHAFCEAA
PMLLLQLYVLVNLQNENHMNAVKLKALASGHHLSSTALVQQTSLAEQQQKTFRDLNMVSATLSLFSVCWALASFSKNVRL
QNVHRLVLTWLGVIFQFLWRLGTVISRVISLTVYASVYSHWVFLVIILHWFSMFLWLISPKNVFHGERISRLKKATLGGL
IAFVYIFAYINLQEVRHRQKMLTFYIVMFMENCLLVGLWMVGIWPNRPEEFGLI