TCDB is operated by the Saier Lab Bioinformatics Group
>tr|B1JXG0|B1JXG0_BURCC Protein MurJ homolog OS=Burkholderia cenocepacia (strain MC0-3) GN=Bcenmc03_2574 PE=3 SV=1
MNLFRALLTVSGFTLLSRVTGLARETLIARAFGASQYTDAFYVAFRIPNLLRRLSAEGAFSQAFVPILAEFKNQQGHDAT
KALVDAMSTVLAWALAVLSVVGIAGASWVVFAVASGLHSDGQAFPLAVTMTRIMFPYIVFISLTTLASGVLNTYKSFSLP
AFAPVLLNVAFIAAAVFVAPHLKVPVYALAWAVIVGGVLQFLVQLPGLKKIDMVPLIGLNPLRALRHPGVKRVLAKMVPA
TFAVSVAQLSLIINTNIASRLGQGAVSWINYADRLMEFPTALLGVALGTILLPSLSKAHVDADSHEYSALLDWGLRVTFL
LAAPSALALFFFATPLTATLFNYGKFDAHTVTMVARALATYGIGLVGIILIKILAPGFYAKQDIKTPVKIAIGVLIVTQL
SNYVFVPLIGHAGLTLSIGVGACLNSLLLFLGLRKRGIYQPSPGWLRFFVQLVGAALVLAGLMHWCAISFDWTGMRAQPL
DRIALMAACLVLFAALYFGMLWVMGFKYAYFRRRAK