TCDB is operated by the Saier Lab Bioinformatics Group
>tr|B2HP37|B2HP37_MYCMM Conserved protein OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=MMAR_0617 PE=4 SV=1
MSESLGLSIGVANLVATRAGGAPLRRASVLHLFQHQAAEVGLPEENPSLAGAGLVLRGFVERVGDQSPLIAADGTKYLGE
ALAVQALSALARTVGYGSPVTIAAPAYWSGAQLGALRGALLTEPALAPNGVAAAVVSDAAAALAALRPTPGFPASGVVAL
CDFGAGGTSVTLAQVGASLQQIGPTFRYREFSGDEIDQLILSHLLTVTPGIDSTEVSGTATSMGSVTLLLGGCRFAKEHL
SAAPVATIATGAAGQPGADIRFSRNEFEQLITQPLDRFIGSVEDMLQRSGVPRPSLAAVAAVGGGAAIPLIGNRLSERLQ
VPVFTTAQPIFSAAIGAAMLGQDQSSAGAPTGAGPAVDMPTNIVGAAGTIGAMTEVSPTAWANQAGSAAASESASDNAKS
ATYRALAWSQDADTGNEPVPYTGPDATGEYGREPATDYAPRYDYPDQDRYAEAAPLPWYKRAAVVFSLAAAGLAILVAVV
LGLTLGTSNNKPVNTTVPAPLPEPITTTILGPNSSPTVTVITPTPPSTTTTSPSATTTTTQPTTTTTTTTTPTTTTTTTT
TTTPPTTTTTTQPTTTRTTTTQATTTAPPTTTQQPSTTTAAPITPTTEAPGA