TCDB is operated by the Saier Lab Bioinformatics Group
>tr|B2IWT1|B2IWT1_NOSP7 ABC-3 protein OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=Npun_F4577 PE=3 SV=1
MDFFNDCQISWLAIASSNDLVSLLTFPFMQRAIVGAVLMGILGGMLGSFVTLRQLSFFSHAVGHAALVGVALGVLLQINP
TWMLLPFTLVFGVIVLYFIDKTDLGSDSVLSIVLSGALAIGVILTSLIKGYRGNLMAVLFGDILAIDTIDLILTLLVLVG
GSIFLLSTLRQQILLTLNPDVAQVQGVPVQLYRYVFVVLLSLAVAVAIKAVGVLLVNAFLVIPASTAKLMSHHFSRFLVI
SVIVGSISSIAGIIVSGIFNLASGPSIVLVQFLLFIAVFIWFKLNLKAA