TCDB is operated by the Saier Lab Bioinformatics Group
>tr|B2N0W4|B2N0W4_ECOLX Putative uncharacterized protein OS=Escherichia coli 53638 GN=Ec53638_4879 PE=4 SV=1
MIVITFNRATFPRLKITMIVRPQQHWLRRIFVWHGSVLSKISSRLLLNFLFSIAVIFMLPWYTHLGIKFTLAPFSILGVA
IAIFLGFRNNAGYARYVEARKLWGQLMIASRSLLREVKTTLPDSASVREFARLQIAFAHCLRMTLRKQPQAEVLAHYLKT
EDLQRVLASNSPANRILLIMGEWLAVQRRNGQLSDILFISLNDRLNDISAVLAGCERIAYTPIPFAYTLILHRTVYLFCI
MLPFALVVDLHYMTPFISVLISYTFISLDCLAEELEDPFGTENNDLPLDAICNAIEIDLLQMNDEAEIPAKILPDRHYQL
T