TCDB is operated by the Saier Lab Bioinformatics Group
>tr|B2WTH9|B2WTH9_MYTCA ABCB/p-glycoprotein-like protein OS=Mytilus californianus PE=2 SV=1
MSESEERKPLLADASDEQESYTDDKKTKDEEKKKPEGPPPATLGQLFRYATSVDTICILFGSLFSLAHGAGWPVLSIVMG
QMTDTFVAGPNGSLIPEGPNATFNPNATTESFEDKMTTYAIYYLIIGGAVLFSGYLQIACFMTACERQVNKIRKHFFRAI
LRQEIGWFDKHQSGELTTRLSDDLERVREGIGDKLSLLIQFTAQFFAGFAIGFWKSWKMTLVMMSLTPVLAILAAYFSSL
MQNFAKREQALYADAGSVAEEVISCMRTVVSFNGQKQEVKRYGKSLEETKQIGIKKSMVTGLLLGSLYLVMFGDYALSFW
YGNEQVKEYITSMGAEGITPGTVLTVFFCVMIGSFSIGNAAPNIGSFVTAKGAAAVVYEIIDREPKIDASSEKGQRPLSI
QGALEFLGVNFTYPTREDVQVLTNFNLSIKPGQTVALVGSSGCGKSTIVNLIQRFYDPDAGQVLLDGNNIKDLNLNWLRQ
NIGVVSQEPVLFGCTIAENIRLGNPNATITEIEQAAKQANAHDFIKSLPQSYNTLVGERGAQLSGGQKQRVAIARALIRD
PRILLLDEATSALDSESENIVQEALEKARQGRTTLVIAHRLSTIQKADIIYVVDKGEIIEQGTHGDLMDKQGLYHSLVTA
QTLVNEDAGFQNQCEDVEFALEEEEEEEAVDAVPDQTVKRPRSRIKSTSSDDKSPQKLSRQMSRQLSRQMSGQPDGKDKA
DKEEEPEEQEEYEPPKYFRMIHENQPECGFIVLGIMASCVAGCTMPAFAIFFGEMIKVFIELGNNGLLWSMMFLALGGIN
FLVYFVQASSFGISGEKLTQRLRLGTFNAYMRQDIAFFDDKFHSTGALTTRLATDASLVKTATGVRIGMVFQSLFGLVAA
LVIAFYYGWALALVVLGIVPVIGFASSLQIKVLKGRHEEDKGKLEDAGKTAAETIENIRTVQSLTTEKHFYHEYSHALVG
PLRSMIKQAHWYGIAFGLGQGVIFMTYAGAFRFGAWQVEIGEMTADNVFKVFFAIAFTAMVIGQSSSFLPEYAKAKHAAG
LIFKAFDTIPPIDIYSKRGTYLQKVDGLIQFKEVNFCYPTRLEVKVLKGVNMKVEPGQTVALVGQSGCGKSTVISLLQRF
YDPESGEIMIDGIDIKDLHLHKMRSFISVVSQEPILFNCSIRDNIAYGLEETAGMDDIITAARDANIHEFITSQPMGYDT
VVGEKGTQLSGGQKQRVAIARALIRNPKILLLDEATSALDSESEKLVQEALDKAQEGRTCIVIAHRLSTIQNADVIFVMD
NGTIVESGTHQTLLAKKGVYNSLVSAQQFIK