TCDB is operated by the Saier Lab Bioinformatics Group
>tr|B2WTI0|B2WTI0_MYTCA ABCC/MRP-like protein OS=Mytilus californianus PE=2 SV=1
MDNSLSVCNTQLSVQDSVTLVEGSYLSQWTPVLFVLAAPFHFLYFKRNFQASVVQYKFILAVFITLIGTLRISIGLRDIH
DILFGEKSPDGLILSISIVLTTIIIQDESHKTQMKKKRKYRFFRIFGLFCSFGISSAYIIHKRTDTTVDNKWELQLIEWT
TQLYCVLISVYLIESVILVLKQVLGTDQSFQKGNADKDVSPEIKASYLSQLTWSWVTPLVLHGYKHNLEQSDLWPLTPGN
VSTNIIPIFEKYWEEEVEKATRERQSQEKRKIQTTTNNVEKQIKANLLNCIIRASGPALLLSAFYKLLYHFAEFAFPYIL
RLLIGITKDRKEDIWKGYILAILMFSVTIFKSVVLNLHIKETQEAGRSNWVALTAVIYKKTLRLTNAAKQDSTVGEIINL
MSVDAEKIGNCVWSLNEVWAVPLLFSMAFYFLWQTLGSSVFVGLIIVLLLVPVNFVLMRKSKQLQLESMDLKDARIKKMN
EVLNGIKVLKMYAWEECFEKCILKIRDQELHILAKREGIQNWMHVIWATTPFTISLCTFGAYVFMDVNNVMSAEKVFVSL
SLFNILQYSLHLVPHVINYFIQTAVSLKRIQNFLNNEELDTSIITRNTDSEYGITVEDGTFVWDTAMEPTLKNIRFKIPE
GLLVAIVGSVGAGKSSLLSAILGEMESETAKVNIKGSIAYVAQQPWIMNTSLQQNILFGQDLDKKKYEYILDASALRKDL
EVLPGGDQTEIGEKGINLSGGQKQRVSLARAVYQNADIYLLDDSLSAVDAHVGKHIFDKIIGSNGLLKEKTRILVTHGLN
FIRKVDIIITMVDGQIGEIGSFDELTGHDGPFAGFMKTYMAEELSTKDAQNKDSYRTLEGIPTNDETMIHSSHSDIVHSI
SDNSNIPIARQMSRQTSCESESSEVLLHNNLVQEENTESVSVKLSVIMTYARAVGFKVALVILAINMVHEVAEMYLDVWL
SKWTQDHTNGTVNETQRNMRLGIYGAIGLFRGVSIFVTETFVTYGLIKATRKLHRDLLRNILRSPMSFFDTTPVGRIVNR
FSKDIETIDDQLIYQFKDVVICLFLVVCNTVVISTGTPHFLFIMLPVTVVYFALQRLYVSTSRQLRMMASAARSPIFSHF
GETISGCSTIRAFQQEERFMIESARRFDVLNTRRSLARSVEKWLHIRLDWLGSIIVLCVCLLVVVNKDDISPGIVGLAIT
YALNVTNCIEWLVKLTTNVGTNIISLERIKEYSETPTEADWIVENKRPEHDWPNEGKVEMDNYGVRYREGLELVLKSISC
KIAPCEKIGIVGRTGAGKSSLTMGLFRILEKAQGCIVIDGIDISTIGLHDLRSKITIIPQDPVLFSGTMRMNLDPFDEYS
NEDIWTALNHAHLKAFVIGLKDGLDHQCSEGGDNLSVGQRQLICLARALLRKTRILVLDEATAAVDLETDDLIQTTIRTE
FADCTILTIAHRLNTIMDYTRIMVLDCGQIREFDSPTNLLLDKNSIFYGMAKDAGLVS