TCDB is operated by the Saier Lab Bioinformatics Group
>tr|B3WF85|B3WF85_LACCB YvcS protein OS=Lactobacillus casei (strain BL23) GN=yvcS PE=4 SV=1
MEEAIPVWHLIKTNLRRHRHEDGLQVLVAALISAVMYAIGAVANNEPILSDASKRLGDLDIVPILLMIVMMVLALFAISF
LLYFNTLLIARRDREIGLYRLLGLSGAKLGLLVCIESLMIGIFGMALGLLLGLIISPLLGMVLIRLMALHTPISLMLSFP
AMVDVVILMGVVYLLVGSINAIYVQNPLRNFIRQQDVSAAPKPQTWWRFSLGIAGVVLLAGSLFTMVHLLPVSGVLMHIL
PRTQGRLIPPLLMGFMLVALLLGLFLVFEEFLPGIVAWFQQRSQMKTRNAHAISRHLIIKRLQGNAHSLWLTTLLCAITI
TMLGSSAMLFQYNQDLVQREIPTTVVAAGAGVDNVTKILAKAKVKPTQAIILSSKLVYAEIRLRDQADQVRKQPGVYNVI
AMRDYQRAAHLQHYLAPVRLRGNEALLMLPTRTSFRPVGARRNPDRAIILPGSDASLLLTRTTNLFPTGRNNFFDRGLLV
SDRTFDMLEGTTDRLYMARLPKSKATAAALRQLQHLENSQNLQEYVNIGSSERDGNDLRVTDRASTTLNFWRNPLGIQSF
QQGIVNTLYGFLFFLILLLGGVFVVATGSILLLKQVIAARQEARHFQILKHLGMDPRQLRLTIYRQAAVVFAVPFLFGTT
IGLCMISVLTTYLDNPPSRYLGLMILIYAIIDWLFYEATVHITARMVDEPVSRWAID