TCDB is operated by the Saier Lab Bioinformatics Group
>tr|B4RDQ2|B4RDQ2_PHEZH OmpA family protein OS=Phenylobacterium zucineum (strain HLK1) GN=PHZ_c0337 PE=3 SV=1
MAAPPEGNERALIMKLKLLAGAAMAAAFAASAAQAQVGWYGAVDLGYHWPEQFEMDSSNNAPNGNPYVWDFNQEEDWAGF
ARLGYQVTDNWRVELELGYRGGDLESVRGGSNQAVLGLCTPGVVRTAAAPTCGSPDGDVTSWTVMGNVIYDIMPGSSINP
FIGGGIGINHVSMETLGQFSNVPGITAANPAIQNLTIDDDDTAFAWQLLAGVAWRATDRLNVDLTYRYLGGSDLDFDSTG
SNAGGLQPGVFSGEYRDSSVTLGLRYSFAAPPPPPPPPPPPPPPPPPPPPPPPPPAPAYEAKQFIVYFPFDQYVLTPEAQ
QVVTEAANYAKGGNATRVVVVGHADTSGSQAYNVRLSERRAKAVADALVGSGVNQTSLSVDWKGETMPAVATGDGVKEPL
NRRSTIDINF