TCDB is operated by the Saier Lab Bioinformatics Group
>tr|B6EQY0|B6EQY0_ALISL Putative exported protein OS=Aliivibrio salmonicida (strain LFI1238) GN=VSAL_II0356 PE=4 SV=1
MKYITLSFFLISLTPFYSNAKETVQNHDDVDMSDPMSVYTGGDIKAGDKGLGGSLQFSVGQHNWAAMGKIEGTNNFETYR
ARIFVPNKKTGTGIYIDSGKDDHIDGLSSNYATVGLLQVIPINKKLKLYAGITYGKSWESNHLYKDTNLINTPIYAKYNI
NDKFFILASPQYQYGLNGEEFRDFYAELNVGYKIDKSNVILFTGSTDEQTWVTYKFKI