TCDB is operated by the Saier Lab Bioinformatics Group
>tr|B7B640|B7B640_9PORP Putative uncharacterized protein OS=Parabacteroides johnsonii DSM 18315 GN=PRABACTJOHN_00484 PE=4 SV=1
MIQLLKDKSNIMQAFWLGFGRLSSFALAFVSAAILSRFLSKEDYGTYKQIMYLYASFSLIFMAGLPETLTYFLPKLKKEE
QKYLVLQFEIIFIFLGLLFSSCLYFGSSTIAEILNNPTLADALKIYAPVPLLLMPTFTMESIYMNEHKSHYQAIYLIFSR
FMVLCGITLPVIFYQASCQVALHGLVFSSACMLIVALFLIAKPYKGYHCQRSHLNIRDVIGYSIPLLSADFALMLFNSAD
QFFISRYFGEAVFAEYSNGFIQFPLATMVSGSVLTVLIPMFSQANTTKKLNEAIRSWQNAIRKTCLLLYPILVFCFFFAT
EIVTFIYGKNYTCSAIYFQIILISNLFNIYPFLPLLLALKKLKVYSSFYFLSALSIWVTEAIGIRLFSSPIAIACISITN
TILLVVVFYLYIKRELQTTVFTSRILLFLSKVLFHSLLTASLIYWSTSAFQESYPPLITLLMAFLLFYLVLVASSRLFGL
NYMSILVHLFNSFTNKIMDVQIKLYRNKWISGNGIHSIGWASTPDTCYPDKAFHQFIESQIDPNTFGADDAYQLANTLNG
SYALVITTHQSVFLIADRTRSYPLIYLKNKGVLYITDDFLSLKADYVLKPTVDISQAETFLLSSLTFGNHTIYKEVFGIQ
AAEIVELSKQNETAKSKRYFRYTLNTENKQQLITKEEINKQNEIFAHVFQRMSDSAPTVHNWIVPLSGGHDSRMIINQIH
KLGIKNVICFSYGEVNNRQAQLSQRVANALGYPWYFVEYTAEKWYQIRQTADFNRYFDFAFNGISNPHIQDLLAVYELNK
QGVFHPDDIFVPGHTFDFITGSQCLRNIKELQSEKDVINYLRYCINQWSYKTRPKHLLKEITDMIRQTPLPYNNFTEYFY
WQEWHCKFLLNSVRVYEYFGFDWRAPLWDQELVKYWQSLHVDYKLYRNFLYECEQQGLYNEPLRSIPFDFQMNPKARTID
KLLRLIPYTFIRKIKHYIRPQAIHLDDGLHHVYAHQKTILKDQATYNSCPKALQNYLKPYKNRPLCWFPDNDNNSMYALR
EQFKQEVFS