TCDB is operated by the Saier Lab Bioinformatics Group
>tr|B7FGM3|B7FGM3_MEDTR Transmembrane protein 50A, putative OS=Medicago truncatula GN=MTR_3g073300 PE=2 SV=1
MDLIELWAIFGPGVAGAVFGAGWWIWLDAVVCSSTTVPFLHYLPGIFASLAGLMFNCVRKEDIDYSPYDEGEWRLKLWLF
IAYVVSFVSLAGSAGLLIQDSLDKSSPSVWTGIAGVLQCVFVLISGLIYWTSHPE