TCDB is operated by the Saier Lab Bioinformatics Group
>tr|B7LBF5|B7LBF5_ECO55 Putative enzyme OS=Escherichia coli (strain 55989 / EAEC) GN=yfcF PE=4 SV=1
MSKPAITLWSDAHFFSPYVLSAWVALQEKGLSFHIKTIDLDSGEHLQPTWQGYGQTRRVPLLQIDDFELSESSAIAEYLE
DRFAPPTWERIYPLDLENRARARQIQAWLRSDLMPIREERPTDVVFAGAKKAPLTAEGKASAEKLFAMAEHLLVLGQPNL
FGEWCIADTDLALMINRLVLHGDEVPERLVDYATFQWQRASVQRFIALSAKQSG