TCDB is operated by the Saier Lab Bioinformatics Group
>tr|B7U3X1|B7U3X1_CHLTR Major outer membrane protein (Fragment) OS=Chlamydia trachomatis GN=omp1 PE=4 SV=1
LMIDGILWEGFGGDPCDPCTTWCDAISMRVGYYGDFVFDRVLKTDVNKEFQMGAAPTTSDVEGLQNDPTTNVARPNPAYG
KHMQDAEMFTNAAYMALNIWDRFDVFCTLGATTGYLRGNSASFNLVGLFGTKTQYSKFNTANLVPNTALDRAVVELYTDT
TFAWSVGARAALWECGCATLGASFQYAQSKPKVEELNVLCNASEFTINKPKGYVGVEFPLDITAGTEAATGTKDASIDYH
EWQASLALSYRLNMFTPYIGVKWSRVSFDADTIRIAQPKLAEAILDVTTLNPTIAGKGAVVSSGSDNELA