TCDB is operated by the Saier Lab Bioinformatics Group
>tr|B8CZ18|B8CZ18_HALOH Putative uncharacterized protein OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) GN=Hore_17880 PE=4 SV=1
MIPERVDNLERDLFKKVLIIATFPMVGLIIAGRWDGLLGLLVGIIISFLLFRLKIIHINRALDMDKGRAINYLRKRYFIN
YIIYFIALFQAYEKSRVYFIATAVGLLLLKYTILGTGIIEYASDWWHRKLEHLEEIDKRRNWDESRT