TCDB is operated by the Saier Lab Bioinformatics Group
>tr|B8R664|B8R664_9CAUD Putative uncharacterized protein OS=Lactobacillus phage Lv-1 PE=4 SV=1
MKINDYLGLLIIVAWIIKSFFDYLKVKDPKMAEKFQIVDDIAEWAVSLQATKDISNAQKQVNATQAVVEQAKKVGVPITE
ASAKGAVEKAVAEKKSIPQPEPVKASEIKSAPVPAVTITKQDDRLDDLHL