TCDB is operated by the Saier Lab Bioinformatics Group
>BAH03288.1 hepcidin antimicrobial peptide 4 [Pagrus auriga]
MKTFSVAVAVAVVLTFICLQESSAVSFTEVQEQEEPMSNDSPVAAHEEMSEESWKMPYNNRHKRSPAGRNKRRRRCRFCC
GCCPNMIGCGTCCKF