TCDB is operated by the Saier Lab Bioinformatics Group
>tr|C1F5X6|C1F5X6_ACIC5 TonB family C-terminal domain protein OS=Acidobacterium capsulatum (strain ATCC 51196 / DSM 11244 / JCM 7670 / NBRC 15755 / NCIMB 13165 / 161) OX=240015 GN=ACP_1385 PE=4 SV=1
MKTLGKLLFCSLLAAVAGGALPCEAQTPAAASSAPMPTDPAALMQLAAQTNGLAGAGLKPWHIKVAYQTYDAKGNPSQQG
TFEEWWNSPSEYVRHFEGQGLRQESQVNAKGKFIEGAVSLPYFANVIENIYLHPFPKDPTEDGLHLHYKMEKLGKADLNC
VEQIAKGLDTEAGHTLDPVFPTYCFEKDHPMLRLAGSFGQGVYEIMQIASLDGRYLPEDVTLFDDGKKQMTVHLLSGETT
ERWPESMFDPPAGAIQVEELPSHKVLLQGKVIAGRRIGGNNPIYPLDAKLNHQEGKVVLHAIIGSDGRIHSLIAVSAPSK
LLASSALAAVKTWQYKPYLIGGHPVSVETEIHVIYRLGN