TCDB is operated by the Saier Lab Bioinformatics Group
>tr|C1MVA0|C1MVA0_MICPC Predicted protein OS=Micromonas pusilla (strain CCMP1545) GN=MICPUCDRAFT_59113 PE=4 SV=1
MADLDTPTGKARALGFLALAQVIFFKILGAVKALYDRSSPWRLLIDPRKFSCPEGLGDALNRFRRNANDFGYNYAFLCVV
ASILCVITSPFSVFIIAALTMAWGYVMCALGLPSSSFVRTSSVRSFFKSSSSRWRRSSFFSFRTGIRSPRPAPPRRLLPA
PPPRIPTQNPKNPSPEP