TCDB is operated by the Saier Lab Bioinformatics Group
>tr|C3XWE5|C3XWE5_BRAFL Putative uncharacterized protein OS=Branchiostoma floridae GN=BRAFLDRAFT_117101 PE=4 SV=1
MSFQHAPKKAGLPREVLKWLQSLDLTYSVKNVRRDFSNGFLVAEIFSWYYPQSIQMHSYDNGTSLPTKLGNWSQLERVFV
KHSLDIPKELIDGTIHCKPGAAELLVQQTYTILTNRIVKNLPSEQEQIDFTDRSYQLTLPMHARSTVSQALKNNLKITEF
MTDPNVITCQEKAQQLIHKHQQHRVQERVEDPVRFDIQPSIGELAVRIAPTDSIQPEYAVPKPPKAKVPQPPPKSQDPMP
SRTVAFKEITELQHYSSMDRGTRYQPLTNEEETEVTMEMSRPLTVALVVPPPSPAETQPGTPEESDHEEDRLEASAQPAP
PPYSEVAAKLPTYEEATKITDSNGQVTETLSSDDESISSTGRDMTMGNDSIFFLSFVFAFLFNWIGFLMAYCLSSSAAGR
LGALSGFGLSLVKWILIFKHSQCCTDIVDSQTWLWWILIVLGVMICLQGLFNYVRVRRQAIQGNNRHYLFFYY