TCDB is operated by the Saier Lab Bioinformatics Group
>tr|C3Y7J9|C3Y7J9_BRAFL Putative uncharacterized protein OS=Branchiostoma floridae GN=BRAFLDRAFT_64101 PE=4 SV=1
MVVLRAVLLWASISGIHGNRCTKTLPTTGHVRYSSRESAQALVETFIQSSIKPGETLCFILHDVTNDDASSDVSISMATN
GSVPLLWQLTYEGIEMDYGVKNRYSFYRPKYESKCVCDCPQYGDYCNSKTNRCTDHELDFCYNTYIPDQTAHGCTVYWNS
EESEVCCALYVGKHPESPKYDAVYLSSDGKPIVKLALKVYDSRTDEVVYSYPTFTVALNDRTHRAQHSVRMEVTGDTPTQ
IDSGYYYATSEGTQLYTDASINGLNEFDPRKMGWLKVRDDGTVERPPERTVLGAFHLKTHKCHNKFDYSETWQIYGHGNL
KHHSGSRVEDFYGWVRRVTYSPLRRTVTVIPRYDRLVTVKIGINTTTNVLFFYHDSDLIDFTAEVRVDRHSNRFANITLV
AAVGSLVGSITPYNGADGDRSATVHRFELHVDSPPASNTIKRISLPKMINGTSRMCLSPLSKPNNEVCKTVPFLQEALQD
FFVPPTWRPGNPEDAGPGFNFNWLFDFFGFLNPAEWFDGIQGWLELFAMLLDIALFIAGIFLFIKVSLLVTSGLCLDSLS
HLGDFTAEVVLDRFSNLYANITLVAAVGSLAGTIAPLVTENQHGIPFTFELLVDSPSRVTSVKRVSLPSNIHGHSRMCLS
PLSRPDMQICKKVPFVEEPIGRFLAPSEPKLRAGESQKQRSNNGTILSFQEYMNPGQWLDGVQTPLESAAIAVDVFLILL
IAGFVASFSVCNCGGHLRKDIDWEPTEEEPQAPVPKAGKKKSTEKPSLVGYSNRKGTKGQTKSKLIHHVNNNIKKSGTIH
SVKKEEEQAQTGKNGTVVTFTFVVVLYPLGGKGRFSQCFELGVKTTYSVIQQ