TCDB is operated by the Saier Lab Bioinformatics Group
>tr|C3Z435|C3Z435_BRAFL Putative uncharacterized protein OS=Branchiostoma floridae GN=BRAFLDRAFT_78467 PE=4 SV=1
MWEKLLFCFCAVMACIAGSAAAPRIAKDQTTNHHRSKRAAQAAIAKFAGEAAMDIGGKVVDALGDRIAEAVVENHQEKVV
SGLEEYFSGQFDRADEEFDKVLSRGGDLLSGVGSDLKEAKLTMINGRGSNTGDTFSPPDQEIRMEFEHVDDSDEGTTDGI
TPISYPMGLGSVLMNGCFGTNYSTGDPCYEAFVPIEACANIIDGATFLGVGFDGRGEYSTDSRKKSLIQRSCNGLQGYKE
FHVPDTMTVQGIYNTDVETYSFTSVEEYRQYLETKSSVTTATAMFQQEMNKVQGHLAKSGVFGLFYSVGVGFGVQWGSDS
EASALSANSAASADLSEGTTQTFVAMLELNVYRYEIFLDFVTPEDLNLAFLRDFLGLPSTYFAIGADREFQNFLLRWGTH
YITSAKFGGQLKIVKVKEATEEDNQSTFAQAAQADFKQLFSTYTSVQTQIKSSSWWHDQDFKTDSQLSSGSSSADSASQE
SLRDQAARVTTDYSNEFMIVQGGNQQIAAAITEFYTTAFGSELKSWLDSIEEFPKAFEFTMALITDLFDMNFDLLFPHGL
LDYGCFGSKDLSVDDKGRRYYVEDSEDPNTSQQHANIRFCNFDTQERFTESVTNRRLALERAIAVYLEEGPFVSADFSIP
AGEPGCETSELALLHDSNVGAPRWQDMISGGEFNVIFDLPADIPNFLVSKYAVRVKYVKHRWLTMRDGVHPHTYDGHRNG
NSGDITWNKISVGGLVMTYDQDTGLFTVTPEDFEASSQVIPDLPDWINDMPVARAEYKSLLRHLSDTGGLDRGLVPCNLR
WSNAHRIDATDGGKCIHFTAASEGDIFVVFASIPRDHESWLSVQISPDGVAMYKSLRLVTSQLERAAKGLGTATLYQSYF
VCIKDDVEAGTTTVQYGKTPDSEERIVVWMDHQFDQVLSLHYYSFGSGAHPVKIMRVSQSDQPGDDFIACGAGLEKSRGR
CVPRNVTEHSCIRNILTKVDMLNVICL