TCDB is operated by the Saier Lab Bioinformatics Group
>tr|C4LT38|C4LT38_ENTHI Putative uncharacterized protein OS=Entamoeba histolytica HM-1:IMSS GN=EHI_148680 PE=4 SV=1
MRIVGGWFTAYNGLLSAVHYVLSSFRKNKKSLFVGVFTVFVSVCFLYILQNVVELVPAVFMRISEIQVGEGDILLQPRES
IFLNYTQISEKLDKNCKTCKNNYPRWLMWGSVVNGNQTVDGILNVYNSELEEKNNIGRGWKYDPLEKDQFVISGGAARKI
GLQVGQEVHIVVSLPEIVRYLGLNMEDILPDLIGVEQNVNIPIPLKFIDPNNTQNGKYIITQLYEIEKILNQTGENIFTS
LYINGIDMYVTEAFNLYVLDKSSPDPYNKFIIENNAILVSVGLNINYSDPELLASMTSIRKMIIKGIAESPGGKYSNLIG
NVISIDQREAEILLKKIFENIISYEIKKVTDKLKQYHIPTTIILNLINNLFGRFEFDLNAQTTQIYVQMKDRNKAYFDGD
KLMKKIIVETTDEIAQILGLKSSITLTAPLSIVVSVFNYLMYLLKEIFNFIVIVFAFMGGLLIYSLLITDVESKTYEFGM
LRALGLLKSLLIEILVVESTTFSIIGVVIGLILGYSLSLIANFLITSLADLPMTYTPSWKSIVIPLLIGFIVPLISNIIP
IKKALSKTLRNSLDLYHSTVNEVNVTIKKIKSIGVRPSLIIISLVMIIASFITYYVIPMSLLQMKLDILFICFLLVLLSF
LAGLCLLSQIIQPFIQNLITYIIITPFQSATQSIVLKNLNSHSPRNKKTALMLTVVISFILFAGAVFSLSESTIINEVKL
TSGADIRVKTSNSLNVTQLENYLKNEPKVIDYSFETSPISDIAGKKSSTYISNLAMCPMDSVKYIAVDEHFVNTVYNELL
TPVKADPIIKYNKINGVPDVLTSLYDFPRVRTSDLPQCFPLNKNIINKQKIPDTSYFYNNYTDVIIAEGIREEDSIHIAD
NVRIKIVSNSHSLFYLGKVRATIKSMPGQRFSSFYTVASKSPIIISIPQMKEILQTQQSLFNTSSDITYPILYVKVQPGS
SEYVTQNIRTLVYDIKAVVTDTSSSVKSIQSSIGILQVFFVIVSLIALLLCFFVMLLSFTSNVYENSWEFAVLRALGLSS
IKMVLIYIYEALCITFSSIILGSLIGIGVASLVNLQFILFLQLPYTFSFPWLNAIIIYVISIVVSITSSFIPSWGLTRKP
ISNVLKGQL