TCDB is operated by the Saier Lab Bioinformatics Group
>tr|C4M2P5|C4M2P5_ENTHI Uncharacterized protein OS=Entamoeba histolytica OX=5759 GN=EHI_006110 PE=4 SV=1
MEYIDKFIYPSNWYSYLFYFVIGITPLIQLVISSSPNLFTLIPLLVITIFLFVNRRTLASFMIITILLSLVSLLSTVVIK
QSIIEFHQLINTITKLVTNLSEDSVNLLISRVEESYSGQIILEYMDKLGLMNYLSLKTIKPAVLQGLKLLSSQVQPYFLI
NLASSVTDNIFAFFIFIYSLLYFLIYQNTILNGISQLIPFDVEVVQIIRNGVASTSLRLILMNSLLFIFKFTLTFVTFSL
AHLPYKMVCSIICALLAILPAFSNMIVWLPAGLVLFFQGNTTGMIWFISVHAVTYFIIDGWFYSFIPDIIPYFVGLSVVF
GVYVFGITGCILGPLVFVMTMTLKDIFILQNQRLKQKIKQD