TCDB is operated by the Saier Lab Bioinformatics Group
>tr|C4M7K7|C4M7K7_ENTHI Putative uncharacterized protein OS=Entamoeba histolytica GN=EHI_170400 PE=4 SV=1
MSKDNQSKTSFKNFGSKASPVPITDTTVSIILDPNKDAQEIAGVLHTYWHMKERQWNRKITMTFTNSSKTFSVLYSISIA
IIFLVYLMLQIFLFKRHNKFIVEYLLEAVLSIACILFGPRLQMKYRILTTEAYLFTITFFICSWYYQPGYYVPYLFCCVL
FGLFSLFIYSTSLRLKRFYISQIRRETGSIRKIVQEDTIRYEIQQDQFFSSPHLCVLESKYSGLVEGESLWIDTSYQGEY
VSGWFEHGEPVGPFESIENGTRNVLHSLRIIFATDAQGKYTNHRKPLHYGVAGVECNVSGNFYLGYPRCRFINGPTLCQC
QGPCQCLNNQFLYYKHSDDNKPVETITVAIDSLNNLSISGFQGDVDDIKLNYDNGQIGIDERWLPIAEEGKEALIYIHGL
NHTLVDALKRLGQLLALGHFPKHIIPFVFSWPSCSNPFLYCCAANVSSDNAVHRDLRRFLYSLRNTKIKKIHFLGHSLGT
RFFLQSFSMLKELFAPTEEFCKDHGLFEVHNLILLSGDYDAATFVDDYPDFIPYIKHVSLYADSRDMALRSSKFMMRGSR
IGQNVSVFKDLNGKKLDDIDVIDTGDLERNIDGANHGFFNINTSMIEDLQEVICSGKTAAQRTSRLVEKDGVYHFTLLPR
SVKM