TCDB is operated by the Saier Lab Bioinformatics Group
>tr|C4X3L3|C4X3L3_KLEPN ATP synthase subunit I OS=Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044 GN=atpI PE=4 SV=1
MTLRLKGRFIRHATYLKGSRSKNVMSVSLLSRNVARKLLFIQLLAVMASGLLFSLKDPFWGISAVCGGLAVVLPNLMFII
FAWRHQAHTPAKGRVAWTFAFGEAFKVLLTFALLAVALAVLKVVFLPLIVTWVLVLVVQVLAPAVINNKG