TCDB is operated by the Saier Lab Bioinformatics Group
>tr|C4XEJ5|C4XEJ5_MYCFP Putative uncharacterized protein OS=Mycoplasma fermentans (strain ATCC 19989 / NBRC 14854 / NCTC 10117 / PG18) GN=MBIO_0302 PE=4 SV=1
MTCFLCTFKEKYTGDLMDNQKEKRVHIIFWSLTLILGLLSLAFFNYKKTKFAVMLGYWIGTSCGFLAYELRELLSFKIIE
TSKNRAIMLGFFGTILNMLWIGLLLFAIFKINSNALNSPYTKTIEKNSFWPINIIAFIPGFMTFYFSLFIGYLSSEKDKK
VQNN