TCDB is operated by the Saier Lab Bioinformatics Group
>tr|C5F3G8|C5F3G8_LACPA Uncharacterized protein OS=Lactobacillus paracasei subsp. paracasei 8700:2 GN=LBPG_00775 PE=4 SV=1
MILLIAGCMQLLMGILLAVFRPRHQSGFWGYTSYLAGVNAESFRLAQRWFCQALIITGALEAGAGWLIHFLAWDNFFIVW
LFLAVLLFLPGFVYTETRLKHYLQAHDALPYDYVSPDDAPKPQRKKGFKDL