TCDB is operated by the Saier Lab Bioinformatics Group
>tr|C6BWI5|C6BWI5_DESAD Putative uncharacterized protein OS=Desulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIB 8403 / VKM B-1763) GN=Desal_2209 PE=4 SV=1
MAYNSNKYRLYLTLSIFVLLAVIISVVISFAFLKTLFATSEIINSIILTVFAGSVFTAFRYIFSVRRDMKLFAAFTDWCE
KPEESTFELDDLNKGLLGNVLVSIGCSIKENGVLIVRSSSDSRSIIESLEQNISSRSSLISFLSGFLVLLGLMGTFLGLT
LTLQSMGDILSTLAGGLTDSSDTSIMQVMIQLIVELKTPMAGMGTAFSTSLFGLAGSAVVGVLSILIGRMHDQLKQRLEN
WLNEKTEYAASKSGNAGTVSPDLDLGSQMAAISTQLEKNNVALLESLENTNKFLLKLTLLQQRSAEAINTVQDQSMETTK
EIGLGNELTGRLIKESRQMVTALERSIETMNIMNERHHKN