TCDB is operated by the Saier Lab Bioinformatics Group
>tr|C6GYU4|C6GYU4_9ACTO PimT protein OS=Streptomyces natalensis GN=pimT PE=4 SV=1
MVSTESILAFAAMSLLVIVIPGPSVLFVIGRALAHGRRTALATVVGNLIGSYVLVVAVAWGLGALVETSAAVLMGVKLAG
AVYLVYLGVQAFRHRKEMRAADMEAPAGERRGDLRTVLDGIFVGVTNPKGIVFFAAVLPQFVDHSTGHVPLQMMVLGLVP
VTIGMITDTLWGLGASAARSWFARSDRRLSMVGGAGGFAMIGLGVTVAATGRAD