TCDB is operated by the Saier Lab Bioinformatics Group
>tr|C6W3T8|C6W3T8_DYAFD Uncharacterized protein OS=Dyadobacter fermentans (strain ATCC 700827 / DSM 18053 / NS114) GN=Dfer_4585 PE=4 SV=1
MHEGTPMRFLLFILLTVPFIGFSQSETKEPVIYSDSTTNYAEFVGMGSTNGYTPFWIQSNQFGIVPKTGPNLSARVGLEH
YWTLSENKTRNELRVGAGVEAVGNFVQTQNFLLPQAHVTLRYKNWELFVGRKKQWVGLADSTIGSGSYAWSGNALPIPKI
SLGTTRFVAVPLTKGWLSFQAFYSDGLFENSRPITSELKFHQKAFYLRIGKPHSLLKLYGGFNHQVQWGGKTKIPLAGEN
GQMPNGLSNYFHAVIGAIGGSGDDITHFDSTSRIGNHLGSIDVAAEIETYENSLLFYKQFVYEDGSLFYMKGIVDGLYGA
RLKRKNSYGANFEIMEAVLEFLYTKDQGGDDFVLGDGKRRGRDNYFNNQQVRDGWGYFDRTIGTPFIPPTSQTKWRWPNY
ADNFTSNNRVMMLHLGLKGTLFRKIEWQGKFSFSENSGAWLEKFEGDPRQFSGMIMMQSKLDVLGGLTVKGAYAADIGDL
YRKTYGFMLGVRKDISFY