TCDB is operated by the Saier Lab Bioinformatics Group
>tr|C7TAQ3|C7TAQ3_LACRG Uncharacterized protein OS=Lactobacillus rhamnosus (strain ATCC 53103 / GG) GN=LRHM_0777 PE=4 SV=1
MKYIGKWLLPFIAAIAVFIGMQFDSGLYTKPIGRVEAVKVVKTESHQDEDQNHDRLVKQQVQVRLLNTANRGRRVTMHNT
YLFSGGLDNQLRVGEQVFLDVNKGTYTLNNVKRDAILAGLLVLTFGLIFLVMGRRAWLTSISILLNTLIFFAAVEWEIGS
KQWQAWWLFVGLAVVFTVLTAVFIVGFKAIAVAISLGSLVATGLAVALGYGIMAMTNYNGVHFEEVKYATQTPQLLFFAQ
VVIGSLGAVLDEASDISVAIFQLHETAKERFRAGMAIGRNVMGPLISVLFMIFIADTFMESVLWIRNNNSIAQTVIWVMG
LGFAQSLISAFGIVLAVPVTSGLAALMAKIKKVTA